DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and Pde7b

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_001334295.1 Gene:Pde7b / 29863 MGIID:1352752 Length:498 Species:Mus musculus


Alignment Length:338 Identity:103/338 - (30%)
Similarity:170/338 - (50%) Gaps:40/338 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 MELLDESL------------SWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAW 761
            :.||||..            :||||||..:.:|:.:.|:.|...:|....:.....:|......:
Mouse   146 LHLLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNGNSLVTLLCHLFNSHGLIHHFKLDMVTLHRF 210

  Fly   762 LAVIEAHYRKSNTYHNSTHAADVMQATGAFITQ------LTNKDMLVMDRMEEATALIAAAAHDV 820
            |.:::..|...|.|||:.|||||.||...::.:      ||..|:::        .|:|||||||
Mouse   211 LVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIML--------GLLAAAAHDV 267

  Fly   821 DHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGD-DKINIFKNLDKETYKSARSTII 884
            ||||.:..||..:|..||.||.:::||||||    ::.|:|. .:..:..:|.||..:.....:.
Mouse   268 DHPGVNQPFLIKTNHHLANLYQNMSVLENHH----WRSTIGMLRESRLLAHLPKEMTQDIEQQLG 328

  Fly   885 DMILATEMTRHFEHLAKFVSVFGGEEPRDHNPQTDEETSILMRRMLIKVADVSNPARPMQFCIEW 949
            .:||||::.|..|.|.:..:....::.|..|.|...    .|.::.:|.||:.||.|..:...:|
Mouse   329 SLILATDINRQNEFLTRLKAHLHNKDLRLENVQDRH----FMLQIALKCADICNPCRIWEMSKQW 389

  Fly   950 ARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFID----MPQ 1010
            :.|:.||::.|.|.|::..|.| .|:.::...|||..||||:.||::.:...|..|..    ...
Mouse   390 SERVCEEFYRQGDLEQKFELEI-SPLCNQQKDSIPSIQIGFMTYIVEPLFREWARFTGNSTLSEN 453

  Fly  1011 LITYMQINYSQWK 1023
            :::::..|.:|||
Mouse   454 MLSHLAHNKAQWK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 81/251 (32%)
Pde7bNP_001334295.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.