DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and Pde3b

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_058925.2 Gene:Pde3b / 29516 RGDID:61943 Length:1111 Species:Rattus norvegicus


Alignment Length:376 Identity:109/376 - (28%)
Similarity:171/376 - (45%) Gaps:70/376 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 NPIIME----LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFD---VFATLNIDENVCKAWL 762
            :|:::|    |:::..:|:|.||:|.|.........|...|:..|.   :..|..|.......:.
  Rat   642 DPMLVEDYDSLIEKMSNWNFQIFELVEKMGEKSGRILSQVMYTLFQDTGLLETFKIPTQEFMNYF 706

  Fly   763 AVIEAHYRKSNTYHNSTHAADVMQA-------------------------------TGAFITQLT 796
            ..:|..|| ...|||..||.||:.|                               :...|..|:
  Rat   707 RALENGYR-DIPYHNRVHATDVLHAVWYLTTRPIPGLQQLHNNHETETKADSDARLSSGQIAYLS 770

  Fly   797 NKDMLVMDR-----------MEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENH 850
            :|...:.|:           :|.....:|||.||.|||||::|||..:|...||||||.:|||||
  Rat   771 SKSCCIPDKSYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENH 835

  Fly   851 HAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFVSVFGGEEPRDHN 915
            |||..:.|.|...:.|...|||...:|..|..:|:.||||::.:|||.||:|     ..:..|.|
  Rat   836 HAASAWNLYLSRPEYNFLLNLDHMEFKRFRFLVIEAILATDLKKHFEFLAEF-----NAKANDVN 895

  Fly   916 PQ----TDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMF 976
            ..    :.|...:|:.::.||:||::.||:.....:.|...|..|::.|.|||....||| .|..
  Rat   896 SNGIEWSSENDRLLVCQVCIKLADINGPAKDRDLHLRWTEGIVNEFYEQGDEEATLGLPI-SPFM 959

  Fly   977 DRATCSIPKSQIGFIEYIIQDMMHAWESFIDMPQLITYMQINYSQWKKYDE 1027
            ||::..:.|.|..||.:|:..:.:::::...:|          .||.:.:|
  Rat   960 DRSSPQLAKLQESFITHIVGPLCNSYDAAGLLP----------GQWIEAEE 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 89/286 (31%)
Pde3bNP_058925.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Interaction with RAPGEF3. /evidence=ECO:0000250 1..32
DUF3488 145..>264 CDD:403269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..448
Interaction with PIK3R6. /evidence=ECO:0000250 421..445
PDEase_I 718..992 CDD:395177 88/279 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.