DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and PDE7B

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_061818.1 Gene:PDE7B / 27115 HGNCID:8792 Length:450 Species:Homo sapiens


Alignment Length:427 Identity:119/427 - (27%)
Similarity:194/427 - (45%) Gaps:80/427 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 TGPSVYSSRRSSNDSI-IRTGSSTRTAAIVPAKMKSNPII--------------------MELLD 713
            ||  |.:.||.|...| .|..:||..:..:..|.|...::                    :.|||
Human    36 TG--VRAERRGSYPFIDFRLLNSTTYSGEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLD 98

  Fly   714 ES--------LS----WDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIE 766
            |.        ||    ||||||..:.:|:.:.|:.|...:|....:.....:|......:|.:::
Human    99 EDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQ 163

  Fly   767 AHYRKSNTYHNSTHAADVMQATGAFITQ------LTNKDMLVMDRMEEATALIAAAAHDVDHPGR 825
            ..|...|.|||:.|||||.||...::.:      ||..|:::        .|:|||||||||||.
Human   164 EDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIML--------GLLAAAAHDVDHPGV 220

  Fly   826 SSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGD-DKINIFKNLDKETYKSARSTIIDMILA 889
            :..||..:|..||.||.:::||||||    ::.|:|. .:..:..:|.||..:.....:..:|||
Human   221 NQPFLIKTNHHLANLYQNMSVLENHH----WRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILA 281

  Fly   890 TEMTRHFEHLAKFVSVFGGEEPRDHNPQTDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIA 954
            |::.|..|.|.:..:....::.|    ..|.:....|.::.:|.||:.||.|..:...:|:.|:.
Human   282 TDINRQNEFLTRLKAHLHNKDLR----LEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVC 342

  Fly   955 EEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFID----MPQLITYM 1015
            ||::.|.:.|::..|.| .|:.::...|||..||||:.||::.:...|..|..    ...::.::
Human   343 EEFYRQGELEQKFELEI-SPLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHL 406

  Fly  1016 QINYSQWKK-----------------YDEQGVNTLAE 1035
            ..|.:|||.                 :|..|..|.:|
Human   407 AHNKAQWKSLLPRQHRSRGSSGSGPDHDHAGQGTESE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 79/251 (31%)
PDE7BNP_061818.1 PDEase_I 172..392 CDD:278654 78/236 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..450 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.