DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and Pde9a

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_036016291.1 Gene:Pde9a / 18585 MGIID:1277179 Length:536 Species:Mus musculus


Alignment Length:533 Identity:138/533 - (25%)
Similarity:230/533 - (43%) Gaps:139/533 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 DVRSIASDGLRRTSLAKLT----------SLPLEAPITK-----------------IINLLSQVQ 623
            |:..||:...|.|:::.||          ::|..:..|.                 |..:|:||.
Mouse    37 DLFCIATGLPRNTTISLLTTDDAMVSIDPTMPANSERTPYKVRPVAVKQVSEREELIQGVLAQVA 101

  Fly   624 ENCS------------ADEARLIDKVLEFLKREGLYSPQMKEIRTDDPIATDLIGALLTGPSVYS 676
            |..|            |:...:::|.:|.   |||...::::.::|.....:.:.|         
Mouse   102 EQFSRAFKINELKAEVANHLAVLEKRVEL---EGLKVVEIEKCKSDIKKMREELAA--------- 154

  Fly   677 SRRSSNDSIIRTGSSTRTAAI----------VPA--KMKSNPIIMELLDESLSWDFDIFKLE--E 727
              |:|     ||....:.:.:          ||.  |...:|..:|.|.:.   .||::..|  |
Mouse   155 --RNS-----RTNCPCKYSFLDNKKLTPRRDVPTYPKYLLSPETIEALRKP---TFDVWLWEPNE 209

  Fly   728 ITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFI 792
            :......:|..:.:.|.|      :|:....:.||..:..:|| :|.:||..|...|.|...:.:
Mouse   210 MLSCLEHMYHDLGLVRDF------SINPITLRRWLLCVHDNYR-NNPFHNFRHCFCVTQMMYSMV 267

  Fly   793 ------TQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHH 851
                  .:.:..|:||:        :.||..||:||||.::.:..|:...|||.|||::.|||||
Mouse   268 WLCGLQEKFSQMDILVL--------MTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHH 324

  Fly   852 AAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFVSVFGGEEPRDHNP 916
            .||.|:: |...:.|||.::..|.::..|..:|.:||||:|.||.|.:..|      :|..::..
Mouse   325 CAIAFQI-LARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSF------KEKMENFD 382

  Fly   917 QTDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATC 981
            .::||...|::.:|||..|:||..|||:....|...:.||||||:|.||...|| |.|..||...
Mouse   383 YSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLP-VAPFMDRDKV 446

  Fly   982 SIPKSQIGFIEYIIQDMMHA----------------WESFIDMPQLITYMQINYSQWKKYDE--- 1027
            :...:|||||::::..|...                |||           :.:|.:.|:.|:   
Mouse   447 TKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLWES-----------REHYEELKQLDDAMK 500

  Fly  1028 -----QGVNTLAE 1035
                 |.|..:||
Mouse   501 EVKAVQRVQAVAE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 85/262 (32%)
Pde9aXP_036016291.1 PDEase_I 250..478 CDD:395177 82/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.