DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and Pde7a

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:NP_001116231.1 Gene:Pde7a / 18583 MGIID:1202402 Length:482 Species:Mus musculus


Alignment Length:369 Identity:111/369 - (30%)
Similarity:183/369 - (49%) Gaps:63/369 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 MELLDESL------------SWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAW 761
            :::|||..            :|:||||..:.:|:.:.|:.|...:|....:....::|....:.:
Mouse   133 LDILDEDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRF 197

  Fly   762 LAVIEAHYRKSNTYHNSTHAADVMQATGAFI------TQLTNKDMLVMDRMEEATALIAAAAHDV 820
            |.:|:..|...|.|||:.|||||.||...::      :.:|..|:|:        :|||||.||:
Mouse   198 LVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILL--------SLIAAATHDL 254

  Fly   821 DHPGRSSAFLCNSNDALAVLYNDLTVLENHH--AAITFKLTLGDDKINIFKNLDKETYKSARSTI 883
            ||||.:..||..:|..||.||.:.:||||||  :|:......|     :|.:|..|:.:...:.|
Mouse   255 DHPGVNQPFLIKTNHYLATLYKNSSVLENHHWRSAVGLLRESG-----LFSHLPLESRQEMEAQI 314

  Fly   884 IDMILATEMTRHFEHLAKFVSVFGGEEPRDHNPQ-----TDEETSILMRRMLIKVADVSNPARPM 943
            ..:||||:::|..|:|:.|         |.|..:     .|.....|:.:|.:|.||:.||.|..
Mouse   315 GALILATDISRQNEYLSLF---------RSHLDKGDLHLDDGRHRHLVLQMALKCADICNPCRNW 370

  Fly   944 QFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFID- 1007
            :...:|:.::.||:|.|.|.||:.||. |.|:.||.|.||...||||:.|:::.:...|..|.| 
Mouse   371 ELSKQWSEKVTEEFFHQGDIEKKYHLG-VSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDT 434

  Fly  1008 --MPQLITYMQINYSQWKKYDEQGVNTLAEIMAKQPPVGKMANS 1049
              ...::.::.:|.:.||.            :.:|.|..:.||:
Mouse   435 RLSQTMLGHVGLNKASWKG------------LQRQQPSSEDANA 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 87/256 (34%)
Pde7aNP_001116231.1 Endonuc-BglII <51..128 CDD:286304
PDEase_I 211..431 CDD:278654 85/242 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.