DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and AgaP_AGAP008967

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_319716.3 Gene:AgaP_AGAP008967 / 1279930 VectorBaseID:AGAP008967 Length:381 Species:Anopheles gambiae


Alignment Length:394 Identity:121/394 - (30%)
Similarity:189/394 - (47%) Gaps:57/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 LSQVQENCSADEARLIDKVLEFLKREGLYSPQMKEIRT------DDPIATDLIGALLTGPSVYSS 677
            ||:||.:....|.           ||.|.|...:::.|      :.|....:..|:..|..|   
Mosquito    15 LSEVQPDAVPPEV-----------REWLASTFTRQLATTRKKSDEKPKFRSVAHAIRAGIFV--- 65

  Fly   678 RRSSNDSIIRTGSSTRTAAIVPAKMKSNPIIMELLDESLSWDFDIFKLEEITDYHPLLYLGMEMF 742
                 |.|.|..|||       |.|:..|.::.:|.....|.||:|.|.|..:..|:.|||.::.
Mosquito    66 -----DRIYRRVSST-------ALMQFPPEVVRVLKTLDDWSFDVFALAEAGNCQPVKYLGYDLL 118

  Fly   743 RRFDVFATLNIDENVCKAWLAVIEAHY-RKSNTYHNSTHAADVMQATGAFITQ------LTNKDM 800
            .|:.:.....:.....:.:|..||..| |..|.|||:.|||||.|.....:.|      ||:   
Mosquito   119 NRYGMIHKFKVPPATLETFLTRIEEGYCRFRNPYHNNLHAADVAQTVHHVLCQTGLMHWLTD--- 180

  Fly   801 LVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKI 865
                 :|....|:||..||.:|.|.::.|...|....|:||||..||||||.:..|:: |.:|..
Mosquito   181 -----LEIFATLLAALIHDYEHTGTTNNFHVMSGSDTAMLYNDRAVLENHHISAAFRV-LKEDDC 239

  Fly   866 NIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFVSVFGGEEPRDHNPQTDEETSILMRRML 930
            |:.:||.::.::..|:.||||:|||:|:.||:.|....::....|     ||.|:..::   .::
Mosquito   240 NVLQNLSRDEFRELRTLIIDMVLATDMSFHFQQLKNMRNLLTLAE-----PQVDKSKAL---SLV 296

  Fly   931 IKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYII 995
            :...|:|:||:......:|...:.||:|.|.|.|::..||. .|:.||....:.:|||||||:|:
Mosquito   297 LHCCDISHPAKRWDIHHKWTMLLLEEFFRQGDLERELGLPF-SPLCDRNNTLVAESQIGFIEFIV 360

  Fly   996 QDMM 999
            :..|
Mosquito   361 EPSM 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 80/231 (35%)
AgaP_AGAP008967XP_319716.3 PDEase_I_N 11..67 CDD:285672 14/70 (20%)
PDEase_I 152..371 CDD:278654 80/231 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.