DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and AgaP_AGAP008304

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_317162.4 Gene:AgaP_AGAP008304 / 1277681 VectorBaseID:AGAP008304 Length:508 Species:Anopheles gambiae


Alignment Length:337 Identity:81/337 - (24%)
Similarity:144/337 - (42%) Gaps:33/337 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 MKSNP-IIMELLDESLSWDFDIFKL--EEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLA 763
            ||..| .:.|:..:.|...|..|..  .::.|:...:.|.|.||...:...:..|.|.....::.
Mosquito   178 MKVKPSSLSEINQDELYRTFPRFDFCPRDVKDHALSVQLAMRMFYDLNFVGSFKIHEYKLARFVL 242

  Fly   764 VIEAHYRKSNTYHNSTHAADVMQATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSA 828
            :::..|| ...|||..||..|.....:.:..|...:..::.:|:..:.||||..||:||.|.|::
Mosquito   243 LVQKGYR-DTPYHNWWHAFSVAHFAYSLMMNLRLIERGIITKMQGFSFLIAAFCHDLDHRGISNS 306

  Fly   829 FLCNSNDALAVLY-NDLTVLENHHAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEM 892
            :...::..||.|| ::.:|.|.||.:....: |.|....|...|....:|.....:.::||||::
Mosquito   307 YQTQTSSPLARLYSSEGSVNERHHLSQAICI-LNDSSSKILDGLSTTEFKECIDYLRELILATDL 370

  Fly   893 TRHFEHL-------AKFVSVFGGEEPRDHNPQTDEETSILMRRMLIKVADVSNPARPMQFCIEWA 950
            ..||..|       |:::              |:.....|:..::|...|:::..:..:.....|
Mosquito   371 ANHFRILPRLKKLRAEYL--------------TEGSNQRLLLSLMITCCDLNDQIKSWKTVQHVA 421

  Fly   951 RRIAEEYFMQTDEEKQRHLPIVMP--MFDRATCSIPKSQIGFIEYIIQDMMHAW-ESFIDMPQLI 1012
            ..:..|:|.:.|.|||..|   .|  |.||....||..||.|:..:|:...... :.|.:....:
Mosquito   422 HLVYAEFFAEGDLEKQMGL---RPNAMMDRKKACIPMLQIEFLTTVIRPTFEILVQIFPETGSFL 483

  Fly  1013 TYMQINYSQWKK 1024
            ..:..|..||::
Mosquito   484 DTIDSNREQWER 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 62/251 (25%)
AgaP_AGAP008304XP_317162.4 GAF 1..161 CDD:214500
PDEase_I 253..487 CDD:278654 62/251 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.