DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and AgaP_AGAP005536

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_315535.4 Gene:AgaP_AGAP005536 / 1276218 VectorBaseID:AGAP005536 Length:934 Species:Anopheles gambiae


Alignment Length:340 Identity:109/340 - (32%)
Similarity:176/340 - (51%) Gaps:34/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAW--LAVIEAHYRKSN 773
            :||....|.|:.|.||.:|....|..|.:.:|..:.:....|:|  |.:.|  .::||..|..:|
Mosquito    90 ILDRVNHWRFNAFTLETVTGGRSLPVLCVHLFHWYGLLDHFNLD--VVRVWKLFSLIEEGYHSTN 152

  Fly   774 TYHNSTHAADVMQATGAFITQ---LTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSND 835
            .||||.||.||.||...|:.:   |.|     :..:|...:||.|..||:||||.:..||..:::
Mosquito   153 PYHNSIHATDVTQAMHCFLQEKRILEN-----LSPLEIMASLIGAVTHDLDHPGVNQPFLIATSN 212

  Fly   836 ALAVLYNDLTVLENHH--AAITFKLTLG--DDKINIFKNLDKETYKSARSTIIDMILATEMTRHF 896
            .||.||.:.:||||||  :||...|..|  :...:|...|:::        |..:||||::||..
Mosquito   213 HLAALYENTSVLENHHWRSAIGCLLESGVAEQVQDIRPELERQ--------ISSLILATDITRQQ 269

  Fly   897 EHLAKFVSVFGGEEPRDHNPQTDEETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQT 961
            |.:.:|.....    ||.....|......:.::.:|.||:|||.||.....:|:.::.||:|.|.
Mosquito   270 EFIGRFRDYLS----RDALDMRDTTHRHFILQISLKCADISNPCRPWDISKKWSTKVCEEFFRQG 330

  Fly   962 DEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFI--DMP-QLITYMQINYSQWK 1023
            |.|:|.:|| |..:.||.:.::||.|.||.::::..:|..|..|:  |:. .::.:::.|.:||:
Mosquito   331 DYERQLNLP-VTSLCDRQSTTVPKIQTGFFKFVVTPLMDEWHRFLRTDLSHSMMHHLKYNQTQWE 394

  Fly  1024 KYDEQGVN--TLAEI 1036
            ...:..:|  |..||
Mosquito   395 SKLQAEINEETRTEI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 83/250 (33%)
AgaP_AGAP005536XP_315535.4 PDEase_I 154..387 CDD:278654 83/250 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.