DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and Pde4c

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_011240550.1 Gene:Pde4c / 110385 MGIID:99556 Length:745 Species:Mus musculus


Alignment Length:446 Identity:141/446 - (31%)
Similarity:224/446 - (50%) Gaps:59/446 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 RTSLAKLTSLPLEAPITKIINLLSQVQENCSADEARLIDKVLEFLKREGLYSPQMKEIRTDDPIA 661
            |.|:.::.|...:..:.:.::.||:.        :|..::|.|::.:  .:..|..|:....|..
Mouse   287 RRSVGEMASNKFKRMLNRELSYLSET--------SRSGNQVSEYISQ--TFLDQQAEVELPQPPT 341

  Fly   662 TDLIGALLTGP----SVYSSRRSSNDSIIRTGSSTRTAAI--VPAKMKSNPIIMELLDESLSWDF 720
            .|       .|    .:...||||:.|:       .||||  ...:......:.:.|:::..|..
Mouse   342 ED-------DPWPMAQITELRRSSHTSL-------PTAAIPRFGVQTDQEEQLAKELEDTNKWGL 392

  Fly   721 DIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVM 785
            |:||:.|::...||..:...:|:..|:..|..|..:...|:|..:|.||.....||||.|||||:
Mouse   393 DVFKVAELSGNRPLTAVIFSVFQERDLLKTFQIPADTLLAYLLTLEGHYHSDVAYHNSMHAADVV 457

  Fly   786 QATGAFITQLTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENH 850
            |:  |.:...|.....|...:|...|:.|.|.|||||||.|:.||.|:|..||::|||.:|||||
Mouse   458 QS--AHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENH 520

  Fly   851 HAAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFEHLAKFVSVFGGEEPRDHN 915
            |.|:.|||..|:: .:||:||..:...|.|..:|||:|||:|::|...||...::.         
Mouse   521 HLAVGFKLLQGEN-CDIFRNLSTKQRLSLRRMVIDMVLATDMSKHMSLLADLKTMV--------- 575

  Fly   916 PQTDEETS------------ILMRRMLIKVADVSNPARPMQFCIEWARRIAEEYFMQTDEEKQRH 968
             :|.:.||            |.:.:.|:..||:||||:|:....:|..||..|:|.|.|.|::..
Mouse   576 -ETKKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPLPLYRQWTERIMAEFFQQGDRERESG 639

  Fly   969 LPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFI--DMPQLITYMQINYSQW 1022
            |.| .||.|:.|.|:.|||:|||:||.|.:...|...:  |..:|:..::.| .:|
Mouse   640 LDI-SPMCDKHTASMEKSQVGFIDYIAQPLWETWADLVHPDAQELLDTLEDN-REW 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 100/254 (39%)
Pde4cXP_011240550.1 PDE4_UCR 213..329 CDD:375549 8/51 (16%)
PDEase_I 447..688 CDD:365964 100/254 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 1 1.000 - - FOG0000302
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.