DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and pde7a

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_031760262.1 Gene:pde7a / 100498541 XenbaseID:XB-GENE-1013813 Length:480 Species:Xenopus tropicalis


Alignment Length:329 Identity:99/329 - (30%)
Similarity:167/329 - (50%) Gaps:39/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 LLDESLSWDFDIFKLEEITDYHPLLYLGMEMFRRFDVFATLNIDENVCKAWLAVIEAHYRKSNTY 775
            :|::..||.||||..:.:|:.:.|:.|...:.....:.....:|....:.:|.:::..|...|.|
 Frog   162 MLEKVGSWSFDIFLFDRLTNGNSLVTLTFHLLSHHGLIDHFQLDMVKLRRFLVMVQEDYHSQNPY 226

  Fly   776 HNSTHAADVMQATGAFITQ------LTNKDMLVMDRMEEATALIAAAAHDVDHPGRSSAFLCNSN 834
            ||:.|||||.||...|:.:      .|..|:|:        .|||||.||:||||.:.:||..:|
 Frog   227 HNAVHAADVTQAMYCFLKEPKLAKSFTPWDILL--------GLIAAATHDLDHPGVNQSFLIKTN 283

  Fly   835 DALAVLYNDLTVLENHH--AAITFKLTLGDDKINIFKNLDKETYKSARSTIIDMILATEMTRHFE 897
            ..||.||.:.:||||||  :|:......|     :|.::..|..:.....:..:||||:::|..|
 Frog   284 HYLATLYKNTSVLENHHWRSAVGLLRESG-----LFAHMTLEERQHMEGQLGSIILATDISRQNE 343

  Fly   898 HLAKFVSVFGGEEPRDHNPQTD-----EETSILMRRMLIKVADVSNPARPMQFCIEWARRIAEEY 957
            :|::|         |.|..:.|     ....:.:.:|.:|.||:.||.|..:...:|:.::.||:
 Frog   344 YLSQF---------RTHLDRGDLCLDNASDRLFILQMALKCADICNPCRTWELSKQWSEKVTEEF 399

  Fly   958 FMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHAWESFID---MPQLITYMQINY 1019
            |.|.|.|::..|. |.|:.||.|.:|...|||||.|:::.:...|..|.:   ...::.::.:|.
 Frog   400 FYQGDVERKYKLD-VSPLCDRQTSNIANIQIGFITYLVEPLFVEWARFSNTRLSQTMLGHVGLNK 463

  Fly  1020 SQWK 1023
            :.||
 Frog   464 ASWK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 82/256 (32%)
pde7aXP_031760262.1 PDEase_I 226..459 CDD:395177 82/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.