DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde8 and pde9a

DIOPT Version :9

Sequence 1:NP_001163275.2 Gene:Pde8 / 37741 FlyBaseID:FBgn0266377 Length:1050 Species:Drosophila melanogaster
Sequence 2:XP_002944249.2 Gene:pde9a / 100488870 XenbaseID:XB-GENE-5917012 Length:344 Species:Xenopus tropicalis


Alignment Length:335 Identity:103/335 - (30%)
Similarity:161/335 - (48%) Gaps:35/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 RTGSSTRTAAIVPAKMKSN---PIIMELLDESLSW-DFDIFKLEEITDYHPLLYLGMEMFRRFDV 747
            ||..|:...:.|||. |.|   ..|.|...|:|.. .|::..:|.    ..:|.|...||.:.|:
 Frog     4 RTEQSSDPPSNVPAP-KGNQHRTQIPEGTREALKRPTFNVLGMER----PQMLSLLEHMFYQLDL 63

  Fly   748 FATLNIDENVCKAWLAVIEAHYRKSNTYHNSTHAADVMQATGAFITQ------LTNKDMLVMDRM 806
            .||..::....:.:|:.::.||:: |.:||..|...|.|.....|:|      |...|.|.|   
 Frog    64 VATFKMEPETLRCFLSSVQEHYQE-NPFHNFHHGFSVAQMLYCVISQCQLQERLLPSDTLAM--- 124

  Fly   807 EEATALIAAAAHDVDHPGRSSAFLCNSNDALAVLYNDLTVLENHHAAITFKLTLGDDKINIFKNL 871
                 ::||..||:||||.|:::..|:...||..||..:.|||||.|:|.:: |..:|.|:..|:
 Frog   125 -----MVAALCHDLDHPGLSNSYQVNAQTDLAKRYNYNSPLENHHWAVTLRI-LSQEKSNLLVNV 183

  Fly   872 DKETYKSARSTIIDMILATEMTRHFEHLAKFVSVFGGEEPRDHNPQTDEETSILMRRMLIKVADV 936
            ..|.....:..|:::||||:|..|.:.|.....:       :....::.|....:::.|||:.|:
 Frog   184 APEQLPHIQQEIMELILATDMVHHGKILQSLQHI-------ETLSFSNREHVTALKKTLIKLCDI 241

  Fly   937 SNPARPMQFCIEWARRIAEEYFMQTDEEKQRHLPIVMPMFDRATCSIPKSQIGFIEYIIQDMMHA 1001
            ||.|||......||..:.||||:|:|.||...|| |.|..||.......:|..||.:::..:..|
 Frog   242 SNEARPADQAEVWADSLMEEYFLQSDREKAEGLP-VTPYMDRDRVRKADAQSSFITFLLLPLCEA 305

  Fly  1002 WESFIDMPQL 1011
            ...  .:|||
 Frog   306 LCQ--HLPQL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde8NP_001163275.2 PAS 459..539 CDD:238075
PAS_9 463..539 CDD:290162
PDEase_I 775..1016 CDD:278654 78/243 (32%)
pde9aXP_002944249.2 PDEase_I 90..317 CDD:365964 78/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.