DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and glpF

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_418362.1 Gene:glpF / 948422 ECOCYCID:EG10396 Length:281 Species:Escherichia coli


Alignment Length:270 Identity:79/270 - (29%)
Similarity:122/270 - (45%) Gaps:55/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVF--LGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAY 123
            :.|.:|||:|:|  :||:..:|.........:|.:.:|..|.:||.....|||||||||||:|.:
E. coli    12 IAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALW 76

  Fly   124 IYEMVTLRMAFAYFAAQMLGAF----IGYGLLMVL--------------LPSPTLTVGAGLCVTL 170
            ::.....|....:..:|:.|||    :.|||...|              :.|..|   ||...|.
E. coli    77 LFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDL---AGTFSTY 138

  Fly   171 PHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVG-IRFGLAIACLACAAGPFTGGSMN 234
            |:..:...||..:|.|||:||:.:...:.|..|......:. :..||.||.:..:.||.||.:||
E. coli   139 PNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMN 203

  Fly   235 PARSFAPALWNKHFESNWI---------------YWLAPL----SSSAITAYAYKVVFRRE---- 276
            |||.|.|.::      .|:               |:|.||    ..:.:.|:||:.:..|.    
E. coli   204 PARDFGPKVF------AWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAIVGAFAYRKLIGRHLPCD 262

  Fly   277 --VVEAEITS 284
              |||.:.|:
E. coli   263 ICVVEEKETT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 74/250 (30%)
glpFNP_418362.1 MIP 10..254 CDD:238204 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I390
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Inparanoid 1 1.050 92 1.000 Inparanoid score I335
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.