DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and aqpZ

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_415396.1 Gene:aqpZ / 945497 ECOCYCID:EG13270 Length:231 Species:Escherichia coli


Alignment Length:233 Identity:65/233 - (27%)
Similarity:100/233 - (42%) Gaps:20/233 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KISAFLGELIGTGILVFLGCMGCVKTDLFPN---NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPA 117
            |::|   |..||..|||.||...|....||.   ....:.|.||..||......|.:||.|.|||
E. coli     4 KLAA---ECFGTFWLVFGGCGSAVLAAGFPELGIGFAGVALAFGLTVLTMAFAVGHISGGHFNPA 65

  Fly   118 VTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPT-LTVGAGLCVTLPHTSVTTG--- 178
            ||:..:.......:....|..||::|..:...||.::....| ....|....:..:...:.|   
E. coli    66 VTIGLWAGGRFPAKEVVGYVIAQVVGGIVAAALLYLIASGKTGFDAAASGFASNGYGEHSPGGYS 130

  Fly   179 --QALGIEFVITSILVIVCCGVWDPRNSKFHDS--VGIRFGLAIACLACAAGPFTGGSMNPARSF 239
              .||.:|.|:::..::|..|..|    ||..:  ..|..|||:..:...:.|.|..|:|||||.
E. coli   131 MLSALVVELVLSAGFLLVIHGATD----KFAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARST 191

  Fly   240 APALWNKHF--ESNWIYWLAPLSSSAITAYAYKVVFRR 275
            |.|::...:  |..|.:|:.|:....|....|:.:..:
E. coli   192 AVAIFQGGWALEQLWFFWVVPIVGGIIGGLIYRTLLEK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 64/225 (28%)
aqpZNP_415396.1 PRK05420 1..231 CDD:235453 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51421
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.