DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQP10

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_011508406.1 Gene:AQP10 / 89872 HGNCID:16029 Length:302 Species:Homo sapiens


Alignment Length:276 Identity:75/276 - (27%)
Similarity:106/276 - (38%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDL----FPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA 121
            |.|.:|..:|:.|...|.|...:    ...|...:.|....||.|||...|.|||||||||.::|
Human    25 LAEFLGVFVLMQLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLA 89

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL----LPSPTLTVGAGLCVT------------- 169
            ..|...:.......|...|:|.||...|...||    |.:.|   |..|.||             
Human    90 MCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYT---GGNLTVTGPKETASIFATYP 151

  Fly   170 LPHTSVTTG---QALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIR---FGLAIACLACAAGPF 228
            .|:.|:..|   |.||...:|..:|.|:     |.||...  ..|:.   .|:.|..|..:.|..
Human   152 APYLSLNNGFLDQVLGTGMLIVGLLAIL-----DRRNKGV--PAGLEPVVVGMLILALGLSMGAN 209

  Fly   229 TGGSMNPARSFAPAL------WNKHFESN-----WIYWLAPLSSSAITAYAYKVVFR------RE 276
            .|..:||||...|.|      |.....|.     |:..:|||..:.:....|:::..      .|
Human   210 CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPE 274

  Fly   277 VVEAEITSNEKLRQLE 292
            ..:..:::..|..:||
Human   275 PAQDLVSAQHKASELE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 71/248 (29%)
AQP10XP_011508406.1 MIP 13..266 CDD:294134 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.