DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and FPS1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_013057.1 Gene:FPS1 / 850683 SGDID:S000003966 Length:669 Species:Saccharomyces cerevisiae


Alignment Length:278 Identity:62/278 - (22%)
Similarity:104/278 - (37%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLG----CM----GCVKTDLF----PNNHL-------------------- 89
            :..||.|.:||.:::..|    |.    |.::.|.|    .|.::                    
Yeast   253 LKEFLAEFMGTMVMIIFGSAVVCQVNVAGKIQQDNFNVALDNLNVTGSSAETIDAMKSLTSLVSS 317

  Fly    90 -------QIVLNFGFAVLIAIQCFG--CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAF 145
                   .:.|.:..||::...|.|  .:|||||||::|:|..:|....|:....|||.|::|||
Yeast   318 VAGGTFDDVALGWAAAVVMGYFCAGGSAISGAHLNPSITLANLVYRGFPLKKVPYYFAGQLIGAF 382

  Fly   146 IGYGLLMVLLPSPTLTVG----------AGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWD 200
            .| .|::.:.....|...          ||:....|...:::|:....||:..::|......:.|
Yeast   383 TG-ALILFIWYKRVLQEAYSDWWMNESVAGMFCVFPKPYLSSGRQFFSEFLCGAMLQAGTFALTD 446

  Fly   201 PRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAP------------ALWNKHFESNWI 253
            |......|...:...:.|..:..:....||.:||.||...|            .||..|....|:
Yeast   447 PYTCLSSDVFPLMMFILIFIINASMAYQTGTAMNLARDLGPRLALYAVGFDHKMLWVHHHHFFWV 511

  Fly   254 YWLAPLSSSAITAYAYKV 271
            ..:.|...:.:....|.|
Yeast   512 PMVGPFIGALMGGLVYDV 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 62/276 (22%)
FPS1NP_013057.1 MIP 244..527 CDD:395174 60/274 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.