DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQY2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_013048.1 Gene:AQY2 / 850674 SGDID:S000003975 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:74 Identity:22/74 - (29%)
Similarity:31/74 - (41%) Gaps:16/74 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FKMKGSTL-DKISAFLGELIGTGILVFLGC----MGCVKTDL---------FPNNHLQIVLNFGF 97
            |.:...|| :...|.:||..||  .:||.|    ......|:         .|...:.|.|.|||
Yeast    37 FNIDRDTLRNHFIAAVGEFCGT--FMFLWCAYVICNVANHDVALTTEPEGSHPGQLIMIALGFGF 99

  Fly    98 AVLIAIQCF 106
            :|:.:|.||
Yeast   100 SVMFSIWCF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 19/61 (31%)
AQY2NP_013048.1 GlpF 1..149 CDD:223653 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.