powered by:
Protein Alignment Eglp4 and AQY2
DIOPT Version :9
Sequence 1: | NP_001261154.1 |
Gene: | Eglp4 / 37739 |
FlyBaseID: | FBgn0034885 |
Length: | 297 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013048.1 |
Gene: | AQY2 / 850674 |
SGDID: | S000003975 |
Length: | 149 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 74 |
Identity: | 22/74 - (29%) |
Similarity: | 31/74 - (41%) |
Gaps: | 16/74 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 FKMKGSTL-DKISAFLGELIGTGILVFLGC----MGCVKTDL---------FPNNHLQIVLNFGF 97
|.:...|| :...|.:||..|| .:||.| ......|: .|...:.|.|.|||
Yeast 37 FNIDRDTLRNHFIAAVGEFCGT--FMFLWCAYVICNVANHDVALTTEPEGSHPGQLIMIALGFGF 99
Fly 98 AVLIAIQCF 106
:|:.:|.||
Yeast 100 SVMFSIWCF 108
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Eglp4 | NP_001261154.1 |
MIP |
59..272 |
CDD:294134 |
19/61 (31%) |
AQY2 | NP_013048.1 |
GlpF |
1..149 |
CDD:223653 |
22/74 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0580 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000054 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.