DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AQY3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_116601.1 Gene:AQY3 / 850490 SGDID:S000001840 Length:646 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:60/235 - (25%)
Similarity:100/235 - (42%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ELIGTGILVFLGCMGCVKTDLFP---NNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYI 124
            |.:||.:||..|..|.::..:..   .::..:...:||..::.:...|.:||.|:|||||::..|
Yeast   353 EFLGTLVLVIFGVGGNLQATVTKGSGGSYESLSFAWGFGCMLGVYVAGGISGGHINPAVTISMAI 417

  Fly   125 YEMVTLRMAFAYFAAQMLGAFIG----YGLLMVLLP----SPTL-TVGAGLCV-TLPHTSVTTGQ 179
            :.....:....|..||::||:.|    ||.....:.    .|.: |...|.|: |.|.:.||...
Yeast   418 FRKFPWKKVPVYIVAQIIGAYFGGAMAYGYFWSSITEFEGGPHIRTTATGACLFTDPKSYVTWRN 482

  Fly   180 ALGIEFVITSILVIVCCGVWDPRNS-KFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPAL 243
            |...||:..||||.....:.|..|: ..:....:..|..:|.:..|.|..|..::||||...|.:
Yeast   483 AFFDEFIGASILVGCLMALLDDSNAPPGNGMTALIIGFLVAAIGMALGYQTSFTINPARDLGPRI 547

  Fly   244 WNK------------HFESNWIYWLAPLSSSAITAYAYKV 271
            :..            |:...|..|..|::.....|..|.:
Yeast   548 FASMIGYGPHAFHLTHWWWTWGAWGGPIAGGIAGALIYDI 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 60/235 (26%)
AQY3NP_116601.1 MIP 348..557 CDD:238204 54/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X153
TreeFam 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.