DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP6;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_178191.1 Gene:NIP6;1 / 844415 AraportID:AT1G80760 Length:305 Species:Arabidopsis thaliana


Alignment Length:222 Identity:71/222 - (31%)
Similarity:108/222 - (48%) Gaps:14/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ELIGTGILVFLGCMGCV---KTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYI 124
            |.:||.||:|.|....:   ||| .....:....:.|.||:|.|...|.:||||||||||:|...
plant    85 EFVGTLILIFAGTATAIVNQKTD-GAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAA 148

  Fly   125 YEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVIT- 188
            .:....:....|..||:: |.:.....:..:..||::.|    ||:|  :|...||..:||:|: 
plant   149 LKHFPWKHVPVYIGAQVM-ASVSAAFALKAVFEPTMSGG----VTVP--TVGLSQAFALEFIISF 206

  Fly   189 SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWI 253
            :::.:|.....|.|  ...:..||..|..:......|||.|..||||.|:..||:...::.:.|:
plant   207 NLMFVVTAVATDTR--AVGELAGIAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWV 269

  Fly   254 YWLAPLSSSAITAYAYKVVFRREVVEA 280
            |..||:..:.|.|..|.:|...|..||
plant   270 YLTAPILGALIGAGTYTIVKLPEEDEA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 67/212 (32%)
NIP6;1NP_178191.1 PLN00026 1..305 CDD:177663 71/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.