DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP3;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_177462.1 Gene:TIP3;1 / 843653 AraportID:AT1G73190 Length:268 Species:Arabidopsis thaliana


Alignment Length:233 Identity:73/233 - (31%)
Similarity:105/233 - (45%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DKISAFLGELIGTGILVFLGCMGCVKTDLF------------PNNHLQIVLNFGFAVLIAIQCFG 107
            |.|.|.|.|.:.|.:.||......:..|..            |...:.:.|...||:..|:....
plant    21 DSIRATLAEFLSTFVFVFAAEGSILSLDKLYWEHAAHAGTNTPGGLILVALAHAFALFAAVSAAI 85

  Fly   108 CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPH 172
            .|||.|:|||||..|.:...||...|..|:.||:|||.:.. ||:.|..:....||..|.     
plant    86 NVSGGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAILAC-LLLRLTTNGMRPVGFRLA----- 144

  Fly   173 TSVTTGQALGIEFVIT-SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA 236
            :.|.....|.:|.::| .::.:|...:.||:.........:..||.:.......|||:|.|||||
plant   145 SGVGAVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLAIGLIVGANILVGGPFSGASMNPA 209

  Fly   237 RSFAPALWNKHFESNWIYWLAPLSSSAITA--YAYKVV 272
            |:|.|||....:..:||||:.|...||:.|  |.|.|:
plant   210 RAFGPALVGWRWHDHWIYWVGPFIGSALAALIYEYMVI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/227 (31%)
TIP3;1NP_177462.1 MIP 11..268 CDD:412216 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.