DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and AT1G52180

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_175629.1 Gene:AT1G52180 / 841648 AraportID:AT1G52180 Length:124 Species:Arabidopsis thaliana


Alignment Length:120 Identity:35/120 - (29%)
Similarity:46/120 - (38%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 AAQMLGAFIGYGLLMV-----------LLPSPTLTVGAGLCVTLPHTSVTTG--QALGIEFVITS 189
            |...:..|||...|.|           |...||..     .:.:...:|..|  |.:.:|.:||.
plant     2 AVDEVSIFIGVASLTVSVWWFINKFTYLEAVPTSN-----AIPIHSVAVRVGSTQRVVMEIIITF 61

  Fly   190 ILV-IVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPAL 243
            .|| .|.....|..|........:...|.:.....|||||:||.|||.|||..:|
plant    62 ALVYTVYATAIDSNNGTLGTIAPLAIRLIVGANILAAGPFSGGPMNPGRSFGSSL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 35/120 (29%)
AT1G52180NP_175629.1 MIP <29..122 CDD:294134 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.