DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP3;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_174472.2 Gene:NIP3;1 / 840079 AraportID:AT1G31885 Length:323 Species:Arabidopsis thaliana


Alignment Length:218 Identity:67/218 - (30%)
Similarity:104/218 - (47%) Gaps:8/218 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLF--PNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVT 119
            :...:||.:||..::|.||...|..:.:  |.....|.|.:|..|.:.|...|.|||||.||||:
plant    42 VQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLVVTVMIYSIGHVSGAHFNPAVS 106

  Fly   120 VAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL--LPSPTLTVGAGLCV-TLPHTSVTTGQAL 181
            :|....:.........|.|||:||:.:...:|.::  |.....::...:.| |.|..|.||  :.
plant   107 IAFASSKKFPFNQVPGYIAAQLLGSTLAAAVLRLVFHLDDDVCSLKGDVYVGTYPSNSNTT--SF 169

  Fly   182 GIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNK 246
            .:||:.|..|:.|...|...:.:. ....||..|..|......:||.:|.|||||||..|||...
plant   170 VMEFIATFNLMFVISAVATDKRAT-GSFAGIAIGATIVLDILFSGPISGASMNPARSLGPALIWG 233

  Fly   247 HFESNWIYWLAPLSSSAITAYAY 269
            .::..|:|.::|:..:...|:.|
plant   234 CYKDLWLYIVSPVIGALSGAWTY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 67/216 (31%)
NIP3;1NP_174472.2 MIP 37..271 CDD:294134 67/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.