DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and BETA-TIP

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_173223.1 Gene:BETA-TIP / 838359 AraportID:AT1G17810 Length:267 Species:Arabidopsis thaliana


Alignment Length:237 Identity:76/237 - (32%)
Similarity:111/237 - (46%) Gaps:29/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DKISAFLGELIGTGILVFLGCMGCVKTDLF------------PNNHLQIVLNFGFAVLIAIQCFG 107
            |.|.|.|.|.:.|.:.||.|....:..|..            |...:.:.|....|:..|:....
plant    21 DSIRATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGLVLVALAHALALFAAVSAAI 85

  Fly   108 CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPH 172
            .|||.|:|||||.||.|...:::..|..|:.||::||.:.. ||:.|..:....||..:.     
plant    86 NVSGGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILAC-LLLRLATNGLRPVGFHVA----- 144

  Fly   173 TSVTTGQALGIEFVITSILV-IVCCGVWDPRNSKFHDSVGIRFGLAIACLACA----AGPFTGGS 232
            :.|:....|.:|.::|..|| :|.....||:..    |:||...|||..:..|    .|||.|.|
plant   145 SGVSELHGLLMEIILTFALVYVVYSTAIDPKRG----SIGIIAPLAIGLIVGANILVGGPFDGAS 205

  Fly   233 MNPARSFAPALWNKHFESNWIYWLAPLSSSAITA--YAYKVV 272
            |||||:|.|||....:.::||||:.|....|:.|  |.|.::
plant   206 MNPARAFGPALVGWRWSNHWIYWVGPFIGGALAALIYEYMII 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 74/231 (32%)
BETA-TIPNP_173223.1 MIP 11..267 CDD:412216 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.