DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP2;4

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_200874.1 Gene:PIP2;4 / 836187 AraportID:AT5G60660 Length:291 Species:Arabidopsis thaliana


Alignment Length:242 Identity:69/242 - (28%)
Similarity:110/242 - (45%) Gaps:24/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCV----KTDLFPN-------NHLQIVLNFGFAVLIAIQCFGCVSGA 112
            |.:.|.:.|.:.:::..:..:    :||....       ..|.|...||..:.:.:.|...:||.
plant    40 AVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGG 104

  Fly   113 HLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTT 177
            |:||||||..::...|:|.....|..||.|||..|.|.:.....|.....|.|........:..|
plant   105 HINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGT 169

  Fly   178 GQALGIEFVITSILVIVCCGVWDP-RNSKFHDS-----VGIRFGLAIACLACAAGPFTGGSMNPA 236
            |  ||.|.:.|.:||.......|| ||::  ||     ..:..|.|:..:..|..|.||..:|||
plant   170 G--LGAEIIGTFVLVYTVFSATDPKRNAR--DSHVPVLAPLPIGFAVFMVHLATIPITGTGINPA 230

  Fly   237 RSF-APALWN--KHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEA 280
            ||| |..::|  |.::..||:|:.|:..:|..|:.::.:.|...::|
plant   231 RSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 67/232 (29%)
PIP2;4NP_200874.1 MIP 31..266 CDD:395174 67/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.