DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP2;3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_199556.1 Gene:TIP2;3 / 834794 AraportID:AT5G47450 Length:250 Species:Arabidopsis thaliana


Alignment Length:243 Identity:84/243 - (34%)
Similarity:113/243 - (46%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TLDKISAFLGELIGTGILVFLGCMGCV-----KTD--LFPNNHLQIVLNFGFAVLIAIQCFGCVS 110
            ::..:.|:|.|.|.|.:.||.|....|     .:|  |.|...:.|.:...||:.:.:.....:|
plant    14 SVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANIS 78

  Fly   111 GAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPS----PTLTVGAGLCVTLP 171
            |.|||||||:...|...:||...|.|:.||.||:.:.. ||:|.:.:    ||..|.|||     
plant    79 GGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVAC-LLLVFVTNGKSVPTHGVSAGL----- 137

  Fly   172 HTSVTTGQALGI--EFVITSILV-IVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSM 233
                  |...|:  |.|:|..|| .|.....||:.........|..|..:.....|||||:||||
plant   138 ------GAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSM 196

  Fly   234 NPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVF--RREVVE 279
            ||||||.||:.:......||||:.||...|:....|..||  ..|.||
plant   197 NPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSYEAVE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 79/226 (35%)
TIP2;3NP_199556.1 PLN00166 1..250 CDD:165733 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.