DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP4;2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001330234.1 Gene:NIP4;2 / 833760 AraportID:AT5G37820 Length:319 Species:Arabidopsis thaliana


Alignment Length:239 Identity:75/239 - (31%)
Similarity:113/239 - (47%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDL-------FPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAV 118
            :.|:|||..::|.|| |.|..::       ||.    |.:.:|..|::.|...|.:||||.||||
plant    82 IAEMIGTYFIIFSGC-GVVVVNVLYGGTITFPG----ICVTWGLIVMVMIYSTGHISGAHFNPAV 141

  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGI 183
            ||...::..........|..||:.|:.:. .|.:.|:.:.|.....|   |.|..|  :||||..
plant   142 TVTFAVFRRFPWYQVPLYIGAQLTGSLLA-SLTLRLMFNVTPKAFFG---TTPTDS--SGQALVA 200

  Fly   184 EFVITSILVIVCCGV-WDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKH 247
            |.:|:.:|:.|..|| .|.|.:  .:..||..|:.|......|||.:|.|||||||..||:....
plant   201 EIIISFLLMFVISGVATDSRAT--GELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMGR 263

  Fly   248 FESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKLRQL 291
            ::..|:|.:.|........:.|.  |.|       .:::.||:|
plant   264 YKGIWVYIVGPFVGIFAGGFVYN--FMR-------FTDKPLREL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/218 (32%)
NIP4;2NP_001330234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.