DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP4;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_198597.1 Gene:NIP4;1 / 833759 AraportID:AT5G37810 Length:283 Species:Arabidopsis thaliana


Alignment Length:220 Identity:69/220 - (31%)
Similarity:101/220 - (45%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDL-------FPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAV 118
            :.|:|||..:||.|| |.|..::       ||.    |.:.:|..|::.|...|.:||||.||||
plant    46 IAEMIGTYFIVFSGC-GVVVVNVLYGGTITFPG----ICVTWGLIVMVMIYSTGHISGAHFNPAV 105

  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFI-GYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALG 182
            ||...|:..........|..||..|:.: ...|.::...:|....|     |.|..|  ..:||.
plant   106 TVTFAIFRRFPWHQVPLYIGAQFAGSLLASLTLRLMFKVTPEAFFG-----TTPADS--PARALV 163

  Fly   183 IEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKH 247
            .|.:|:.:|:.|..|| ...|....:..||..|:.|......|||.:|.|||||||..|||....
plant   164 AEIIISFLLMFVISGV-ATDNRAVGELAGIAVGMTIMVNVFVAGPISGASMNPARSLGPALVMGV 227

  Fly   248 FESNWIYWLAPLSSSAITAYAYKVV 272
            ::..|:|.:.|:.......:.|.::
plant   228 YKHIWVYIVGPVLGVISGGFVYNLI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 69/218 (32%)
NIP4;1NP_198597.1 PLN00182 1..283 CDD:165748 69/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.