DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001190920.1 Gene:PIP3 / 829662 AraportID:AT4G35100 Length:280 Species:Arabidopsis thaliana


Alignment Length:232 Identity:67/232 - (28%)
Similarity:104/232 - (44%) Gaps:24/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA 121
            ::..:|....||....:|.:|             |...||..:.:.:.|...:||.|:|||||..
plant    55 VATVIGHKKQTGPCDGVGLLG-------------IAWAFGGMIFVLVYCTAGISGGHINPAVTFG 106

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFV 186
            .::...|:|..|..|..||.|||..|.|.:...:.:|..|:|.|  ........:.|.|||.|.:
plant   107 LFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGG--ANTVADGYSKGTALGAEII 169

  Fly   187 ITSILVIVCCGVWDPRNSKFHDS-----VGIRFGLAIACLACAAGPFTGGSMNPARSF-APALWN 245
            .|.:||.......||:.|. .||     ..:..|.|:..:..|..|.||..:|||||| |..::|
plant   170 GTFVLVYTVFSATDPKRSA-RDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN 233

  Fly   246 --KHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEA 280
              |.::..||:|:.|...:...|..::.:.|...::|
plant   234 NEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 65/220 (30%)
PIP3NP_001190920.1 MIP 30..259 CDD:395174 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.