DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP1;5

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_194071.1 Gene:PIP1;5 / 828439 AraportID:AT4G23400 Length:287 Species:Arabidopsis thaliana


Alignment Length:228 Identity:67/228 - (29%)
Similarity:104/228 - (45%) Gaps:14/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLN-----FGFAVLIAIQCFGCVSGAHLNPAV 118
            |.:.|.|.|.:.:::..:..:.....||....:.:.     ||..:...:.|...:||.|:||||
plant    54 AGIAEFIATFLFLYVTVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV 118

  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGI 183
            |...::...::|..|..|...|.|||..|.|::....|....|.|.|..| :.| ..|.|..||.
plant   119 TFGLFLARKLSLTRALFYIVMQCLGAICGAGVVKGFQPGLYQTNGGGANV-VAH-GYTKGSGLGA 181

  Fly   184 EFVITSILVIVCCGVWDPRNSKFHDSVGI----RFGLAIACLACAAGPFTGGSMNPARSFAPA-L 243
            |.|.|.:||.......|.:.|.....|.|    ..|.|:..:..|..|.||..:|||||...| :
plant   182 EIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII 246

  Fly   244 WNKH--FESNWIYWLAPLSSSAITAYAYKVVFR 274
            :||.  ::.:||:|:.|...:|:.|..:::|.|
plant   247 YNKDHAWDDHWIFWVGPFIGAALAALYHQIVIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 65/224 (29%)
PIP1;5NP_194071.1 MIP 45..274 CDD:395174 65/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.