DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP1;3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_192056.1 Gene:TIP1;3 / 828051 AraportID:AT4G01470 Length:252 Species:Arabidopsis thaliana


Alignment Length:239 Identity:74/239 - (30%)
Similarity:103/239 - (43%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KGSTLDKISAFLGELIGTGILVFLG-----CMGCVKTD--LFPNNHLQIVLNFGFAVLIAIQCFG 107
            :.|..|.|.|...|.....|.||.|     ..|.:..|  ..|...:...|:..||:.:|:....
plant    13 EASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAASLSHAFALFVAVSVGA 77

  Fly   108 CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL---LPSPTLTVGAGLCVT 169
            .|||.|:|||||..|:|...:||..|..|:.||:|||.:...||.|.   :.:...::..|    
plant    78 NVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYG---- 138

  Fly   170 LPHTSVTTGQALGIEFVIT-SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSM 233
                 ||...|:..|.|:| .::..|.....||:.........:..||.:.......|.|.|.||
plant   139 -----VTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASM 198

  Fly   234 NPARSFAPA----LWNKHFESNWIYWLAPLSSSAITAYAYKVVF 273
            |||.||.||    :|..|    |:||:.|...:||.|..|..:|
plant   199 NPAVSFGPAVVSWIWTNH----WVYWVGPFIGAAIAAIVYDTIF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/227 (31%)
TIP1;3NP_192056.1 PLN00027 1..252 CDD:177664 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.