DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NLM1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_567572.1 Gene:NLM1 / 827641 AraportID:AT4G19030 Length:296 Species:Arabidopsis thaliana


Alignment Length:249 Identity:69/249 - (27%)
Similarity:107/249 - (42%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLFPNNHL----QIVLNFGFAVLIAIQCFGCVSGAHLNPA 117
            :...:.|.:||..|||.||...|..  ..|:::    .|.:.:|..:::.|...|.:||||:|||
plant    54 LQKLIAEFLGTYFLVFTGCASVVVN--MQNDNVVTLPGIAIVWGLTIMVLIYSLGHISGAHINPA 116

  Fly   118 VTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLL----------------PSPTLTVGAGL 166
            ||:|........|:...||..:|::|:.:....|.:|.                .||   ||:.|
plant   117 VTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHDVCSGKHDVFIGSSP---VGSDL 178

  Fly   167 CVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGG 231
                        ||..:||::|..|:.:..|| ...|....:..|:..|..:......|.|.:..
plant   179 ------------QAFTMEFIVTFYLMFIISGV-ATDNRAIGELAGLAIGSTVLLNVLIAAPVSSA 230

  Fly   232 SMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSN 285
            ||||.||..|||....::..|||.:||...:...|:.|..|...:....|||.:
plant   231 SMNPGRSLGPALVYGCYKGIWIYLVAPTLGAIAGAWVYNTVRYTDKPLREITKS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 65/232 (28%)
NLM1NP_567572.1 PLN00184 1..296 CDD:177778 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.