DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP1;2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_193626.1 Gene:NIP1;2 / 827626 AraportID:AT4G18910 Length:294 Species:Arabidopsis thaliana


Alignment Length:257 Identity:78/257 - (30%)
Similarity:115/257 - (44%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KVFKMKGSTLDKISAFL----GELIGTGILVFLGCMGCV------KTDLFPNNHLQIVLNFGFAV 99
            |..|.:.|.|.....||    .|::||..|:|.||....      |....|.    |.:.:|..|
plant    35 KPLKKQDSLLSISVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPG----IAIVWGLTV 95

  Fly   100 LIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL------LPSP 158
            ::.:...|.:||||.|||||:|........|:...||..:|::|:.:....|.:|      :.|.
plant    96 MVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSG 160

  Fly   159 TLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLAC 223
            ...|..|   |||  |.:..|:..|||:||..|:.|..|| ...|....:..|:..|..:.....
plant   161 KHDVFVG---TLP--SGSNLQSFVIEFIITFYLMFVISGV-ATDNRAIGELAGLAVGSTVLLNVI 219

  Fly   224 AAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSN 285
            .|||.:|.||||.||..||:....:...|||.::|:..:...|:.|.:|...:....|||.:
plant   220 IAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/228 (31%)
NIP1;2NP_193626.1 PLN00184 1..293 CDD:177778 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.