DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP2;2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_193465.1 Gene:TIP2;2 / 827446 AraportID:AT4G17340 Length:250 Species:Arabidopsis thaliana


Alignment Length:254 Identity:84/254 - (33%)
Similarity:115/254 - (45%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GSTLDKIS-----AFLGELIGTGILVFLG-----CMGCVKTD--LFPNNHLQIVLNFGFAVLIAI 103
            ||..|..|     |:|.|.|.|.:.||.|     ....:.:|  |.|...:.:.:...||:.:.:
plant     7 GSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGV 71

  Fly   104 QCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPS----PTLTVGA 164
            .....:||.|||||||:...:...:|:...|.|:.||.||:.:.. ||:|.:.:    ||..|.|
plant    72 SIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVAC-LLLVFVTNGESVPTHGVAA 135

  Fly   165 GLCVTLPHTSVTTGQALGI--EFVITSILV-IVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAG 226
            ||           |...|:  |.|:|..|| .|.....||:.........|..|..:.....|||
plant   136 GL-----------GAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAG 189

  Fly   227 PFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSN 285
            ||:||||||||||.||:.:..|...||||:.||...|:....|..||......|..|.:
plant   190 PFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSYAPAPTTES 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 76/226 (34%)
TIP2;2NP_193465.1 PLN00166 1..250 CDD:165733 84/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.