DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP5;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_192776.1 Gene:NIP5;1 / 826630 AraportID:AT4G10380 Length:304 Species:Arabidopsis thaliana


Alignment Length:244 Identity:80/244 - (32%)
Similarity:115/244 - (47%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CKVFKMKGSTLDK--------------ISAFLG-ELIGTGILVFLGCMGCVKTDLFPNNHLQI-- 91
            ||...:.|||..:              ::..|| |.:||.||:|....|.:....:......|  
plant    49 CKCLPVMGSTWGQHDTCFTDFPSPDVSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAETLIGN 113

  Fly    92 VLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAF-IGYGLLMVLL 155
            ....|.||:|.|...|.:|||||||::|:|.............||.|||:..:. ..:.|..|. 
plant   114 AACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVF- 177

  Fly   156 PSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGV-WDPRNSKFHDSVGIRFGLAIA 219
             .|.::.|    ||:|  ||:.|||..:||:||.||:.|...| .|.|  ...:..||..|..:.
plant   178 -HPFMSGG----VTIP--SVSLGQAFALEFIITFILLFVVTAVATDTR--AVGELAGIAVGATVM 233

  Fly   220 CLACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAP----LSSSAI 264
            .....|||.|||||||.|:..||:.:.::.|.|:|.:||    :|.:|:
plant   234 LNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAISGAAV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 75/215 (35%)
NIP5;1NP_192776.1 PLN00026 29..304 CDD:177663 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.