DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and SIP2;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001190113.1 Gene:SIP2;1 / 824862 AraportID:AT3G56950 Length:260 Species:Arabidopsis thaliana


Alignment Length:251 Identity:59/251 - (23%)
Similarity:99/251 - (39%) Gaps:63/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LGCMGCVKTDLFPNNHLQIVLNFGF---AVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAF 134
            :|.:|.|.|||        ||:|.:   .||:.|...|.:..:..:|:..:..|::.:::: ..|
plant     1 MGRIGLVVTDL--------VLSFMWIWAGVLVNILVHGVLGFSRTDPSGEIVRYLFSIISM-FIF 56

  Fly   135 AY---------------FAAQMLGAFIGYGLLMVLLPSPTLTVGAGLC----------------- 167
            ||               .||.:.|.|..: :..|.:..|...:|:.|.                 
plant    57 AYLQQATKGGLYNPLTALAAGVSGGFSSF-IFSVFVRIPVEVIGSILAVKHIIHVFPEIGKGPKL 120

  Fly   168 -VTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGG 231
             |.:.|.::|.|       ::|..:|::..|:.......|.....|. .||...|.......|||
plant   121 NVAIHHGALTEG-------ILTFFIVLLSMGLTRKIPGSFFMKTWIG-SLAKLTLHILGSDLTGG 177

  Fly   232 SMNPARSFAPALW----NKHF--ESNWIYWLAPLSSSAITAYAYKVVFRREVVEAE 281
            .||||   |...|    .:|.  |...:|||.|:.::.:..:.:||||:....|.|
plant   178 CMNPA---AVMGWAYARGEHITKEHLLVYWLGPVKATLLAVWFFKVVFKPLTEEQE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 54/240 (23%)
SIP2;1NP_001190113.1 MIP 12..218 CDD:294134 47/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.