DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP2;5

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_191042.1 Gene:PIP2;5 / 824647 AraportID:AT3G54820 Length:286 Species:Arabidopsis thaliana


Alignment Length:240 Identity:73/240 - (30%)
Similarity:110/240 - (45%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCV----KTD--LFPN-----NHLQIVLNFGFAVLIAIQCFGCVSGA 112
            |.:.|.|.|.:.:::..|..:    :||  |.|:     ..|.|...||..:.|.:.|...:||.
plant    39 ALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGG 103

  Fly   113 HLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTT 177
            |:|||||....:...|||..|..|..||.|||..|..|:.....:.....|.|........|:.|
plant   104 HINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGT 168

  Fly   178 GQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGI----RFGLAIACLACAAGPFTGGSMNPARS 238
            |.|  .|.:.|.:||.......||:.|.....|.:    ..|.|:..:..|..|.||..:|||||
plant   169 GVA--AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS 231

  Fly   239 FAPA-LWNKH--FESNWIYWLAPLSSSAITAYAYKVVFRREVVEA 280
            ...| ::||.  ::.:||:|:.|.:.:||.|:.::.|.|...::|
plant   232 LGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 70/230 (30%)
PIP2;5NP_191042.1 MIP 30..265 CDD:395174 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.