DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP2A

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001030851.1 Gene:PIP2A / 824510 AraportID:AT3G53420 Length:287 Species:Arabidopsis thaliana


Alignment Length:250 Identity:72/250 - (28%)
Similarity:108/250 - (43%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GSTLDKIS---AFLGELIGTGILVFL----------------GCMGCVKTDLFPNNHLQIVLNFG 96
            |:.|.|.|   |.:.|.:.|.:.:::                |.:.|....:     |.|...||
plant    29 GAELKKWSFYRAVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDCGGVGI-----LGIAWAFG 88

  Fly    97 FAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLT 161
            ..:.|.:.|...:||.|:|||||...::...|:|..|..|..||.|||..|.|.:.....|....
plant    89 GMIFILVYCTAGISGGHINPAVTFGLFLARKVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTR 153

  Fly   162 VGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGI----RFGLAIACLA 222
            .|.|  ........:||..|..|.:.|.:||.......||:.|.....|.:    ..|.|:..:.
plant   154 YGGG--ANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVH 216

  Fly   223 CAAGPFTGGSMNPARSF-APALWNKH--FESNWIYWLAPLSSSAITAYAYKVVFR 274
            .|..|.||..:|||||| |..::||.  ::.:||:|:.|...:||.|:.::.|.|
plant   217 LATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 66/235 (28%)
PIP2ANP_001030851.1 MIP 31..266 CDD:395174 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.