DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP5;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_190328.1 Gene:TIP5;1 / 823898 AraportID:AT3G47440 Length:256 Species:Arabidopsis thaliana


Alignment Length:250 Identity:69/250 - (27%)
Similarity:106/250 - (42%) Gaps:45/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TLDKISAFLGELIGTGILVFLGCMGCVKTD--LFPNNHLQIVLNFGFAVLI-----------AIQ 104
            :::.:..::.|.|.|...| |..:|.|.:.  |...:     ::..|.|||           ::.
plant    18 SMNALRCYVSEFISTFFFV-LAAVGSVMSSRKLMAGD-----VSGPFGVLIPAIANALALSSSVY 76

  Fly   105 CFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVT 169
            ....|||.|:|||||.|..:...:::..|..|:.:||:.:.:...:|.|             .|.
plant    77 ISWNVSGGHVNPAVTFAMAVAGRISVPTAMFYWTSQMIASVMACLVLKV-------------TVM 128

  Fly   170 LPHTSV--TTGQALG-----IEFVITSILVIVCCGVWDPRNSKFHDSVG-IRFGLAIACLACAAG 226
            ..|..:  ..|:..|     :|.|:..:||.......|||.. ...:|| |..|........|||
plant   129 EQHVPIYKIAGEMTGFGASVLEGVLAFVLVYTVFTASDPRRG-LPLAVGPIFIGFVAGANVLAAG 192

  Fly   227 PFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAE 281
            ||:|||||||.:|..|:....|::..:||:.||...|..|..|..|    ||..|
plant   193 PFSGGSMNPACAFGSAMVYGSFKNQAVYWVGPLLGGATAALVYDNV----VVPVE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 65/233 (28%)
TIP5;1NP_190328.1 PLN00167 1..256 CDD:215085 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.