DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP2

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_189283.1 Gene:TIP2 / 822259 AraportID:AT3G26520 Length:253 Species:Arabidopsis thaliana


Alignment Length:245 Identity:71/245 - (28%)
Similarity:101/245 - (41%) Gaps:28/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVK----TD---LFPNNHLQIVLNFGFAVLIAIQCFGCVSGAHL 114
            :.|.|.|.|.|.|.||.|....:.    ||   ..|:..:...|...|.:.:|:.....:||.|:
plant    21 LRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHV 85

  Fly   115 NPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLL---PSPTLTVGAGLCVTLPHTSVT 176
            |||||....:...:||.....|:.||:||:.....||....   |.|...:.||         |.
plant    86 NPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAG---------VG 141

  Fly   177 TGQALGIEFVIT-SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFA 240
            :..||..|.|:| .::..|.....||:|........|..|..:.....|.|.|:|.|||||.:|.
plant   142 SLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFG 206

  Fly   241 PAL----WNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNE 286
            ||:    |..|    |:||..||....:....|..||..|....::.:.:
plant   207 PAVVSWTWTNH----WVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/227 (30%)
TIP2NP_189283.1 PLN00027 1..253 CDD:177664 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.