DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and DELTA-TIP

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_188245.1 Gene:DELTA-TIP / 820870 AraportID:AT3G16240 Length:250 Species:Arabidopsis thaliana


Alignment Length:253 Identity:81/253 - (32%)
Similarity:111/253 - (43%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FKRFSDHFSCCKVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCV-------KTDLFPNNHLQI 91
            |..|.|.||           |..:.|:|.|.|.|.:.||.|....:       ...|.....:.|
plant     6 FGSFDDSFS-----------LASLRAYLAEFISTLLFVFAGVGSAIAYAKLTSDAALDTPGLVAI 59

  Fly    92 VLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL-- 154
            .:..|||:.:|:.....:||.|:|||||....:...:|:.....|:.||:||:.....||..:  
plant    60 AVCHGFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVTG 124

  Fly   155 -LPSPTLTVGAGLCVTLPHTSVTTGQALGI--EFVITSILV-IVCCGVWDPRNSKFHDSVGIRFG 215
             |..||.:|.|||           |...|:  |.:||..|| .|.....||:.........:..|
plant   125 GLAVPTHSVAAGL-----------GSIEGVVMEIIITFALVYTVYATAADPKKGSLGTIAPLAIG 178

  Fly   216 LAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVF 273
            |.:.....|||||:||||||||||.||:....|..:|:||:.||....:....|..||
plant   179 LIVGANILAAGPFSGGSMNPARSFGPAVAAGDFSGHWVYWVGPLIGGGLAGLIYGNVF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 73/225 (32%)
DELTA-TIPNP_188245.1 MIP 1..244 CDD:412216 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.