DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP7;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_566271.1 Gene:NIP7;1 / 819783 AraportID:AT3G06100 Length:275 Species:Arabidopsis thaliana


Alignment Length:273 Identity:81/273 - (29%)
Similarity:121/273 - (44%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ESRKRWTMACDREGSSLFSVALFKRFSDHFSCCKVFKMKGSTLD--KISAFLGELIGTGILVFLG 74
            |:|.|   ..|:|..|..|..   |..||.|..::|......:|  .:...:.||:||.||:|..
plant     4 EARSR---VVDQEAGSTPSTL---RDEDHPSRQRLFGCLPYDIDLNPLRIVMAELVGTFILMFSV 62

  Fly    75 CMGCVKTDLFPNNH---LQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAY 136
            | |.:.:......|   |:..:..|.:|::.:...|.:|||||||::|:|..::..........|
plant    63 C-GVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHLNPSITIAFAVFGGFPWSQVPLY 126

  Fly   137 FAAQMLGA----FIG---YGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIV 194
            ..||.|||    .:|   ||            |.|.:..|.|..|..:  |..:|.:.|||:|.:
plant   127 ITAQTLGATAATLVGVSVYG------------VNADIMATKPALSCVS--AFFVELIATSIVVFL 177

  Fly   195 CCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAPALWNKHFESNWIYWLAPL 259
            ...:....:....:..|...|..|:......||.:|||||||||..||:....||..|||..||:
plant   178 ASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGPAVVAWDFEDLWIYMTAPV 242

  Fly   260 SSSAITAYAYKVV 272
            ..:.|....|:.:
plant   243 IGAIIGVLTYRSI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/222 (31%)
NIP7;1NP_566271.1 PLN00183 1..275 CDD:215092 81/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.