DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and SIP1A

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_187059.1 Gene:SIP1A / 819564 AraportID:AT3G04090 Length:240 Species:Arabidopsis thaliana


Alignment Length:193 Identity:48/193 - (24%)
Similarity:84/193 - (43%) Gaps:36/193 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VLIAIQCFGCVSG-AHLNPAVTVAAYIYEMV--TLRMAFAYFAAQMLGAFIGYGLLMVLLP---- 156
            :.:.:..|..:.| |..||..:.|.|:..:.  ||........||.:||..|...:|..:|    
plant    53 IFVYVSIFTVIFGSASFNPTGSAAFYVAGVPGDTLFSLAIRLPAQAIGAAGGALAIMEFIPEKYK 117

  Fly   157 ----SPTLTVGAGLCVTLPHTS--VTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFG 215
                .|:|.|..       ||.  ..|..:.||.|   ::|:|:..|   ||.     .:...|.
plant   118 HMIGGPSLQVDV-------HTGAIAETILSFGITF---AVLLIILRG---PRR-----LLAKTFL 164

  Fly   216 LAIACLA--CAAGPFTGGSMNPARSFAPA-LWNKH--FESNWIYWLAPLSSSAITAYAYKVVF 273
            ||:|.::  .|...:||.:||||.:|..| :::.|  ::..::||::....:...|..::.:|
plant   165 LALATISFVVAGSKYTGPAMNPAIAFGWAYMYSSHNTWDHIYVYWISSFVGALSAALLFRSIF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 47/190 (25%)
SIP1ANP_187059.1 MIP <123..224 CDD:412216 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.