DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP1B

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001078067.1 Gene:PIP1B / 819204 AraportID:AT2G45960 Length:301 Species:Arabidopsis thaliana


Alignment Length:233 Identity:63/233 - (27%)
Similarity:99/233 - (42%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNHLQIVLN-----FGFAVLIAIQCFGCVSGAHLNPAV 118
            |.:.|.|.|.:.:::..:..:.....||....:.:.     ||..:...:.|...:||.|:||||
plant    53 AGIAEFIATFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAV 117

  Fly   119 TVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGI 183
            |...::...::|..|..|...|.|||..|.|::....|.....:|.| ..|:.| ..|.|..||.
plant   118 TFGLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGG-ANTIAH-GYTKGSGLGA 180

  Fly   184 EFVITSILVIVCCGVWD-PRNSKFHDS-----VGIRFGLAIACLACAAGPFTGGSMNPARSFAPA 242
            |.:.|.:||.......| .||::  ||     ..:..|.|:..:..|..|.||..:|||||...|
plant   181 EIIGTFVLVYTVFSATDAKRNAR--DSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAA 243

  Fly   243 L-------WNKHFES--NW-IYWLAPLSSSAITAYAYK 270
            :       |:.|...  .| |:|.....|  :..|:::
plant   244 IIFNKDNAWDDHVMGLLGWTIHWCCTCCS--LPRYSHQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 63/233 (27%)
PIP1BNP_001078067.1 MIP 44..261 CDD:278651 58/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.