DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP2E

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_181434.1 Gene:PIP2E / 818487 AraportID:AT2G39010 Length:289 Species:Arabidopsis thaliana


Alignment Length:277 Identity:82/277 - (29%)
Similarity:123/277 - (44%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KVFKMKGSTLDKIS---AFLGELIGTGILVFL------------------GCMGCVKTDLFPNNH 88
            |.|:::  .|.|.|   |.:.|.|.|  |:||                  |...|....|     
plant    24 KTFEVR--ELKKWSFYRAVIAEFIAT--LLFLYVTVLTVIGFKSQTDINAGGGACASVGL----- 79

  Fly    89 LQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMV 153
            |.|...||..:.|.:.|...:||.|:|||||...::...|:|..|.:|..||.|||..|.||:.|
plant    80 LGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLASKVSLVRAVSYMVAQCLGATCGVGLVKV 144

  Fly   154 LLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDP-RNSKFHDS-----VGI 212
            ...:.....|.|  ..:.......|..:|.|.:.|.:||.......|| ||::  ||     ..:
plant   145 FQSTYYNRYGGG--ANMLSDGYNVGVGVGAEIIGTFVLVYTVFSATDPKRNAR--DSHIPVLAPL 205

  Fly   213 RFGLAIACLACAAGPFTGGSMNPARSF-APALWN--KHFESNWIYWLAPLSSSAITAYAYKVVFR 274
            ..|.::..:..|..|.||..:|||||| |..::|  |.::..||:|:.|...:||.|:.::.|.|
plant   206 PIGFSVFMVHLATIPITGTGINPARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLR 270

  Fly   275 REVVEAEITSNEKLRQL 291
            ...::|..:...:|.:|
plant   271 AGAMKAYGSVRSQLHEL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 72/239 (30%)
PIP2ENP_181434.1 MIP 30..265 CDD:395174 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.