DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and RD28

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_181255.1 Gene:RD28 / 818294 AraportID:AT2G37180 Length:285 Species:Arabidopsis thaliana


Alignment Length:195 Identity:64/195 - (32%)
Similarity:92/195 - (47%) Gaps:13/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMV 153
            |.|...||..:.|.:.|...:||.|:|||||...::...|:|..|..|..||.|||..|.|.:..
plant    79 LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKA 143

  Fly   154 LLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDP-RNSKFHDS-----VGI 212
            ...|..:..|.|  .........||..|..|.:.|.:||.......|| ||::  ||     ..:
plant   144 FQSSHYVNYGGG--ANFLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNAR--DSHVPVLAPL 204

  Fly   213 RFGLAIACLACAAGPFTGGSMNPARSF-APALWNKH--FESNWIYWLAPLSSSAITAYAYKVVFR 274
            ..|.|:..:..|..|.||..:|||||| |..::||.  ::.:||:|:.|...:.|.|:.::.|.|
plant   205 PIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFVLR 269

  Fly   275  274
            plant   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 62/191 (32%)
RD28NP_181255.1 MIP 29..264 CDD:395174 62/188 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.