DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP2B

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001323849.1 Gene:PIP2B / 818293 AraportID:AT2G37170 Length:328 Species:Arabidopsis thaliana


Alignment Length:241 Identity:70/241 - (29%)
Similarity:105/241 - (43%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFL----------------GCMGCVKTDLFPNNHLQIVLNFGFAVLIAIQCFG 107
            |.:.|.:.|.:.:::                |.:.|....:     |.|...||..:.|.:.|..
plant    81 AVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGI-----LGIAWAFGGMIFILVYCTA 140

  Fly   108 CVSGAHLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPH 172
            .:||.|:|||||...::...|:|..|..|..||.|||..|.|.:.....|.....|.|  .....
plant   141 GISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGG--ANSLA 203

  Fly   173 TSVTTGQALGIEFVITSILVIVCCGVWDP-RNSKFHDS-----VGIRFGLAIACLACAAGPFTGG 231
            ....||..|..|.:.|.:||.......|| ||::  ||     ..:..|.|:..:..|..|.||.
plant   204 DGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNAR--DSHVPVLAPLPIGFAVFMVHLATIPITGT 266

  Fly   232 SMNPARSF-APALWNKH--FESNWIYWLAPLSSSAITAYAYKVVFR 274
            .:|||||| |..::||.  ::.:||:|:.|...:||.|:.::.|.|
plant   267 GINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/237 (29%)
PIP2BNP_001323849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.