DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and GAMMA-TIP

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_181221.1 Gene:GAMMA-TIP / 818255 AraportID:AT2G36830 Length:251 Species:Arabidopsis thaliana


Alignment Length:251 Identity:72/251 - (28%)
Similarity:106/251 - (42%) Gaps:39/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DKISAFLGELIGTGILVFLGC-MGCVKTDL------FPNNHLQIVLNFGFAVLIAIQCFGCVSGA 112
            |.:.|.|.|.|.|.|.|..|. .|.....|      .|:..:...:...|.:.:|:.....:||.
plant    18 DALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISGG 82

  Fly   113 HLNPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLM-----VLLPSPTLTVGAGLCVTLPH 172
            |:|||||..|:|...:||.....|:.||:||:.:...:|.     :.:|:..|:.|.|:.     
plant    83 HVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVL----- 142

  Fly   173 TSVTTGQALGIEFVIT-SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA 236
                  .|...|.|:| .::..|.....||:|........|..|..:.....|.|.|:|.|||||
plant   143 ------NAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPA 201

  Fly   237 RSFAPAL----WNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNEKL 288
            .:|.||:    |..|    |:||..||....|....|:|.|..       |::|:|
plant   202 VAFGPAVVSWTWTNH----WVYWAGPLVGGGIAGLIYEVFFIN-------TTHEQL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 66/229 (29%)
GAMMA-TIPNP_181221.1 PLN00027 1..251 CDD:177664 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.