DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and NIP2;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_180986.1 Gene:NIP2;1 / 818002 AraportID:AT2G34390 Length:288 Species:Arabidopsis thaliana


Alignment Length:261 Identity:72/261 - (27%)
Similarity:116/261 - (44%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ISAFLGELIGTGILVFLGCMGCVKTDLFPNNH----LQIVLNFGFAVLIAIQCFGCVSGAHLNPA 117
            :...|.||:||..|:|.||......  ..:||    :.|.:.:|..:::.:.|.|.:| ||.|||
plant    47 LQKLLAELVGTYYLIFAGCAAIAVN--AQHNHVVTLVGIAVVWGIVIMVLVYCLGHLS-AHFNPA 108

  Fly   118 VTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLL----------------PSPTLTVGAGL 166
            ||:|....:...|....||...|::|:.:....|.:|.                .||:   |:.|
plant   109 VTLALASSQRFPLNQVPAYITVQVIGSTLASATLRLLFDLNNDVCSKKHDVFLGSSPS---GSDL 170

  Fly   167 CVTLPHTSVTTGQALGIEFVITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGG 231
                        ||..:||:||..|::|.|.|...:.:. .:..|:..|..:......||..:|.
plant   171 ------------QAFVMEFIITGFLMLVVCAVTTTKRTT-EELEGLIIGATVTLNVIFAGEVSGA 222

  Fly   232 SMNPARSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEIT-SNEKLRQLEDVQ 295
            |||||||..|||....::..|||.|||...:...|..:|::...:..|.|.: :....:::.|:.
plant   223 SMNPARSIGPALVWGCYKGIWIYLLAPTLGAVSGALIHKMLPSIQNAEPEFSKTGSSHKRVTDLP 287

  Fly   296 L 296
            |
plant   288 L 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 68/232 (29%)
NIP2;1NP_180986.1 MIP 6..283 CDD:412216 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.