DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and TIP4;1

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_180152.1 Gene:TIP4;1 / 817123 AraportID:AT2G25810 Length:249 Species:Arabidopsis thaliana


Alignment Length:226 Identity:69/226 - (30%)
Similarity:107/226 - (47%) Gaps:18/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DKISAFLGELIGTGILVFLGCMGCVKTDLFPNNHL----QIVLNFGFAVLIAIQCFGCVSGAHLN 115
            |.|.|.:.|.|.|.:.||.|....:.||....|.|    .:.:...|.|.:.|.. |.:||.|||
plant    16 DCIKALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLFAVAVAHAFVVAVMISA-GHISGGHLN 79

  Fly   116 PAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVL---LPSPTLTVGAGLCVTLPHTSVTT 177
            ||||:...:...:::..||.|:..|:|.:.....||..|   :.:|..|:.:|:..|        
plant    80 PAVTLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLTGGMGTPVHTLASGVSYT-------- 136

  Fly   178 GQALGIEFVIT-SILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPARSFAP 241
             |.:..|.::| |:|..|...:.||:.........:..|..:.....|.|.|:|.||||||||.|
plant   137 -QGIIWEIILTFSLLFTVYATIVDPKKGSLDGFGPLLTGFVVGANILAGGAFSGASMNPARSFGP 200

  Fly   242 ALWNKHFESNWIYWLAPLSSSAITAYAYKVV 272
            ||.:.::..:|:||:.||....:..:.|:.|
plant   201 ALVSGNWTDHWVYWVGPLIGGGLAGFIYENV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 66/220 (30%)
TIP4;1NP_180152.1 MIP 1..234 CDD:350945 69/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.