DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and PIP2;8

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_179277.1 Gene:PIP2;8 / 816186 AraportID:AT2G16850 Length:278 Species:Arabidopsis thaliana


Alignment Length:238 Identity:71/238 - (29%)
Similarity:110/238 - (46%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFLGELIGTGILVFLGCMGCVKTDLFPNNH---------LQIVLNFGFAVLIAIQCFGCVSGAHL 114
            |.:.|.|.|.:.:::    .|.|.:...|.         |.|...||..:.:.:.|...:||.|:
plant    37 AIIAEFIATLLFLYV----TVATVIGHKNQTGPCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHI 97

  Fly   115 NPAVTVAAYIYEMVTLRMAFAYFAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQ 179
            |||||...::...|:|..|.||..||.|||..|.||:...:.:|...:|.|  ........:||.
plant    98 NPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGG--ANTVADGYSTGT 160

  Fly   180 ALGIEFVITSILVIVCCGVWDPRNSKFHDSVGI----RFGLAIACLACAAGPFTGGSMNPARSF- 239
            |||.|.:.|.:||.......||:.|.....|.:    ..|.|:..:..|..|.||..:|||||| 
plant   161 ALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG 225

  Fly   240 APALWN--KHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEA 280
            |..::|  |.::.:||:|:.|...:...|..::.:.|...::|
plant   226 AAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 69/228 (30%)
PIP2;8NP_179277.1 MIP 28..257 CDD:395174 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.