DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eglp4 and Aqp3

DIOPT Version :9

Sequence 1:NP_001261154.1 Gene:Eglp4 / 37739 FlyBaseID:FBgn0034885 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_113891.2 Gene:Aqp3 / 65133 RGDID:68428 Length:292 Species:Rattus norvegicus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:124/275 - (45%) Gaps:54/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LGELIGTGILVFLGCMGCVKTDLFPNNH---LQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVA- 121
            |.|.:||.|||..||....:..|....|   |.|.|.|||||.:||...|.|||||||||||.| 
  Rat    26 LAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLAILVAGQVSGAHLNPAVTFAM 90

  Fly   122 AYIYEMVTLRMAFAYFAAQMLGAFIGYGL----------------LMVLLPSPTLTVGAGLCVTL 170
            .::.....:::.. |..||.||||:|.|:                |:|..|:.|    ||:..|.
  Rat    91 CFLAREPWIKLPI-YTLAQTLGAFLGAGIVFGLYYDAIWAFAGNELVVSGPNGT----AGIFATY 150

  Fly   171 P--HTSVTTG---QALGIEFVITSILVIVCCGVWDPRNSKFHDSV-GIRFGLAIACLACAAGPFT 229
            |  |..:..|   |.:|...:|..:|.||     ||.|:.....: ....||.:..:..:.|..:
  Rat   151 PSGHLDMVNGFFDQFIGTAALIVCVLAIV-----DPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS 210

  Fly   230 GGSMNPARSFAPAL------WNKHF---ESNWIYW---LAPLSSSAITAYAYKVVFRREVVEAEI 282
            |.::||||.|.|.|      |....   ..|| :|   ::||..|....:.|:::.... :|..:
  Rat   211 GYAVNPARDFGPRLFTALAGWGSEVFTTGQNW-WWVPIVSPLLGSIGGVFVYQLMIGCH-LEQPL 273

  Fly   283 TSNEKLRQLEDVQLS 297
            .|.|    .|:|:|:
  Rat   274 PSTE----AENVKLA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eglp4NP_001261154.1 MIP 59..272 CDD:294134 81/248 (33%)
Aqp3NP_113891.2 MIP 23..264 CDD:238204 81/248 (33%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100415
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X153
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.